7 products were found matching "GeneID 29799"!
No results were found for the filter!
Protein yippee-like 1 (YPEL1), human, recombinant
Item number: CSB-EP026270HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-119aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MVKMTKSKTF QAYLPNCHRT YSCIHCRAHL ANHDELISKS FQGSQGRAYL FNSVVNVGCG PAEERVLLTG LHAVADIYCE NCKTTLGWKY EHAFESSQKY KEGKFIIELA HMIKDNGWE. Purity: Greater...
| Keywords: | YPEL1, FKSG3, Protein yippee-like 1, Recombinant Human Protein yippee-like 1 (YPEL1) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 29.6 kD |
From 213.00€
*
Anti-ZBED2
Item number: 600-401-GA9
Anti-ZBED2 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. This antibody is predicted to have no cross-reactivity to ZBED1 or ZBED3. Protein function: May play a role in epithelioid conversion of fibroblasts. [The UniProt Consortium]
| Keywords: | Anti-YPEL1, Anti-FKSG3, Anti-Protein yippee-like 1 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
684.00€
*
Anti-YPEL1
Item number: G-PACO31124.50
YPEL1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. YPEL1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May play a role in epithelioid conversion of fibroblasts. [The UniProt Consortium]
| Keywords: | Anti-FKSG3, Anti-YPEL1, Anti-Protein yippee-like 1 |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
363.00€
*
NEW
YPEL1 (Vector Vector will be determined during the...
Item number: CSB-CL026270HU.10
Length: 360 Sequence: atggtgaaaa tgacaaagtc caaaactttc caagcgtatc tgccgaactg tcaccgaacg tacagctgta tccactgcag agcacacctg gccaatcatg acgagctcat ctccaagtcc tttcagggga gccagggacg cgcctacctc ttcaattccg tggtgaacgt gggctgcggc cctgcagagg agagggtcct tctcaccggg ctgcatgcgg ttgccgacat ctactgcgag aactgcaaga ccacgctcgg...
| Keywords: | YPEL1, FKSG3, Protein yippee-like 1 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
171.00€
*
YPEL1, Human, Real Time PCR Primer Set
Item number: VHPS-10079
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | FKSG3, YPEL1, Protein yippee-like 1 |
| Application: | RNA quantification |
43.00€
*
YPEL1, Recombinant, Human, aa1-119, His-SUMO-Tag (Protein...
Item number: 375894.100
Source:, Recombinant protein corresponding to aa1-119 from human YPEL1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.6kD, AA Sequence: MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE, Storage and Stability:...
| Keywords: | FKSG3, YPEL1, Protein yippee-like 1 |
| MW: | 29,6 |
From 511.00€
*
Anti-YPEL1
Item number: G-PACO13280.50
YPEL1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, WB, IHC applications. YPEL1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May play a role in epithelioid conversion of fibroblasts. [The UniProt...
| Keywords: | Anti-FKSG3, Anti-YPEL1, Anti-Protein yippee-like 1 |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
491.00€
*